PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn166681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NF-YB
Protein Properties Length: 437aa    MW: 48796.9 Da    PI: 8.0994
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn166681genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB64.91.6e-202791491
       NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                ++i+k++lP + ++++da++++ ec +efi +++se++d c +e++kti+++ +l al  lGf +y+e + +  +++r
  Achn166681  2 TKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNDVCSKEEKKTIAPEHVLKALQVLGFGEYIEDVYAAYEQHR 79
                68******************************************************************9977666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-332121IPR009072Histone-fold
PfamPF008087.4E-18259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.7E-302122IPR009072Histone-fold
TIGRFAMsTIGR015702.2E-63271436IPR006460Protein of unknown function DUF617, plant
PfamPF047591.8E-69271435IPR006460Protein of unknown function DUF617, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESND VCSKEEKKTI APEHVLKALQ  60
VLGFGEYIED VYAAYEQHRL ETMQDSLKGA KWSNVAEMTE EEALAEQQRM FAEARARMNG  120
GATTPKQTDP EATVAKESEL EPRWFSSWCL FRAPSELVPP RMLIRDPSQV KTVMAKSSED  180
VCSKRHFHWT NKVSNKDEEE ETPTLKPPSS NTSHGDEKKE KDKVPPPPGT AASKVAAQRR  240
KLQAIAVSKV RSVFAAFSKN RAHSPGLSPR VIGTLFGHRR GHVHFALQKE PNSPPAFLIE  300
LATPISGLVR EMASGLVRIA LECDKDKEEK KAVVAGRRRL LEEPQWRTYC NGKKCGFAAR  360
RECGPKEWKI LKAVEPISMG AGVLPGDGSE SDKDGEVMYM RAKFERVVGC RDSEAFYMMN  420
PDRNGAPELS IYLLRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-28111521133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883054.11e-130PREDICTED: protein MIZU-KUSSEI 1
TrEMBLF6GTH41e-124F6GTH4_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g04340.t011e-124(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.27e-75nuclear factor Y, subunit B13